jayn********dia.com

Media

Personal Blog

English

.com

Price

฿33,168

Save ฿3,317

฿29,851

$900.00

Prices in currencies other than USD are conversion estimates. Final checkout is processed in USD.

259

LIVE RD

HIST RD

13y 4m

AGE

LANGUAGE

Domain Information

Language

English
TLD

com
Registrar

GNAME
Google Indexed

Yes

Registration Details

Age

13y 4m
Creation Date

27 Mar 2013
WHOIS Date

27 Mar 2013
Non Drop

No

SEO Metrics

Live Referring Domains

259
Historic Referring Domains

0
Live Backlinks

563
Historic Backlinks

N/A

Spam Score

Moz's Spam Score represents the percentage of sites with similar features that have been penalized by Google.

✓ Low Risk

Domain Authority

Moz metric that predicts how well a website will rank on search engines.

Domain Rating

Ahrefs' metric showing the strength of a website's backlink profile.

Page Authority

Moz metric that predicts how well a specific page will rank.

Trust Flow

Majestic's metric measuring link quality based on trusted sites.

Citation Flow

Majestic's metric predicting how influential a URL may be.

Referring Domains

Top 100 referring domains ranked by traffic

Referring Domain	DR	Traffic	Dofollow	Ref Dom	Keywords	Linked Dom
goodfirms.co	86	209.2K	-	16.4K	35.5K	5.7K
buybacklinks.agency	79	0	-	304	0	1
corporatevision-news.com	75	2.5K	12	4.8K	645	8.7K
example3.com	75	0	-	5.0K	17	534
rankyour.website	74	0	-	42	0	2
rank-top.click	74	0	-	43	0	1
businessfirms.co	68	1.6K	8	1.2K	389	36.9K
tntcode.com	57	199	-	5.8K	273	706
theguideliverpool.com	56	17.8K	4	1.5K	4.2K	5.1K
quero.party	54	0	-	390	1	18
bye.fyi	54	0	-	713	5	18
atomizelink.icu	51	0	-	426	0	18
analyticshaven.top	51	0	-	104	0	18
blogsphere.top	51	0	-	54	0	18
artinliverpool.com	50	779	3	587	180	5.9K
metamagic.top	50	0	-	81	0	18
screenshots.wiki	50	0	-	63	0	47
byteshort.xyz	50	0	-	125	0	18
jake.eu	50	0	-	90	0	1.3K
optimizeflow.top	50	0	-	130	0	18
dailymusings.top	50	0	-	49	0	18
liverpoolbidcompany.com	48	495	2	356	226	797
downtowninbusiness.com	42	472	10	311	133	1.2K
find-open.co.uk	42	113	2	1.3K	250	296.8K
thewomensorganisation.org.uk	41	1.4K	3	417	249	689
lisnic.com	40	43	-	909	66	44
backlinker.shop	39	0	-	502	0	0
seo-high-ranking.shop	35	0	-	1.2K	0	37
ekenkoshop.shop	35	0	-	539	0	40
thetoprankingseo.shop	35	0	-	544	0	40
lixil-reformshop.shop	35	0	-	552	0	40
shopbetreiber-blog.shop	35	0	-	551	0	41
highseoranking.shop	35	0	-	541	0	40
therankingseohigh.shop	35	0	-	541	0	40
rankingseohigh.shop	35	0	-	548	0	40
theseomasterhigh.shop	35	0	-	545	0	40
1stdirectory.co.uk	32	6.1K	-	1.0K	2.0K	3.2K
seoagency.sale	32	0	-	336	0	0
eiredigital.com	31	5	-	254	12	12
nettools.guru	29	0	1	1.3K	0	398,968.4K
online.pr	23	1.0K	3	14	339	51.4K
businessvocal.com	23	0	-	306	0	7
agencylist.com	21	338	2	151	125	35.7K
stevenhunt.com	20	23	2	60	12	59
getwebsiteworth.com	18	0	2	340	0	402,147.1K
alljobs.info	17	0	1	121	0	148,533.6K
theprogress-group.co.uk	16	233	8	27	32	65
lifeupnorth.co.uk	13	6	2	168	10	187
hugemedia.co.uk	13	0	2	32	3	65
thecloudherald.com	13	0	-	180	0	2
rankpilot.shop	13	0	-	534	0	0
gamerkun.com	11	0	1	47	0	28,973.5K
agencysource.com	8	8	-	25	17	57
booksreadr.org	8	0	1	150	0	315,277.3K
millfieldestates.com	7	29	7	46	7	172
globalecommerce.org	6	0	1	112	0	234,135.9K
pudhe.com	6	0	2	34	0	241,286.6K
links4you.info	5	0	-	383	0	4
domainwork.space	1	0	1	11	0	9,843.1K
digitalmarketingagencyreviews.co.uk	0	799	-	7	282	0
companiesup.co.uk	0	152	-	55	184	521
sandwayhomes.co.uk	0	43	154	25	5	11
merseysidebased.co.uk	0	2	-	0	8	0
stackwho.com	0	1	2	15	15	81.2K
egyptiandirectory.com	0	0	1	66	0	231,138.6K
themarketingmeetupjobs.com	0	0	2	19	1	510
procycling.org	0	0	1	28	0	18,056.8K
bestwebstats.com	0	0	1	24	0	179,736.4K
seolexo.com	0	0	-	85	0	0
indians.cc	0	0	1	22	0	236,550.1K
domainanalysis.org	0	0	1	22	0	194,856.9K
thirty.co.in	0	0	1	86	0	25,725.4K
nexusnext.agency	0	0	-	61	0	0
mysitemaintenance.com	0	0	2	0	0	0
thehotelproperty.com	0	0	2	0	0	0